HEX
Server: Apache
System: Linux server2.voipitup.com.au 4.18.0-553.111.1.lve.el8.x86_64 #1 SMP Fri Mar 13 13:42:17 UTC 2026 x86_64
User: posscale (1027)
PHP: 8.2.30
Disabled: exec,passthru,shell_exec,system
Upload Files
File: //proc/self/root/proc/self/root/proc/self/root/usr/share/locale/fur/LC_MESSAGES/xkeyboard-config.mo
��id#��FH^I^q^^_�^!0_R_i_�_�_�_�_�_�_�_`-`C`-b`$�`�`�`
�`	�`�`	a%a$;a%`a�a�a�a�a�aC�a"b(b)@b&jb�b
�b�b	�b	�b�b�b�b�bccc6cLcFbc�c�c�c�c�c�c	dd
-d;dMd]dsd�d�dW�dYe[ede}e�e�e�e�e4�ef)f8fGfNfVf^fjf�f�f�f	�f�f�f	�f
�f	�f+�f	)gT3g�g�g�g"�g�g�g�gh1h
Bh
MhXhkhh�h�h�h�h�h"�hi1iNi[ili}i�i(�i�i,�i#&j#Jjnj�j#�j"�j�j�jk$k7k$Kk?pk%�k�k�k�kl	l&l ?l`lhlwl�l�l�l �l m	,mJ6m>�mE�mnn+nDn9Zn.�n@�n@oGEoT�o"�opp!p:pZpqp�p�p�p�p�p�pqqq$q4q
AqLqaqvq�q�q�q�q�q�qr2rPrjr�r%�r$�r!�r�r+s-As
os}s
�s�s�s"�s�s"�st+tGtdtltst�t �t�t�t�t�tuu&uEuZuru�u�u�u�u�u�u�u�uvv)vDvXv*av#�v�v�v�v�v$�vA w;bw.�w(�w�wxx'6x^x|x�x�x�x�x�xy/yIy[yly�y�y�y)�y�y�y%z>z#]z�z�z�z�z�z3�z@-{#n{�{(�{�{%�{|4(|]|m|	}|�|�|3�|�|�|}$&}K}	c}	m}	w}	�}�}�}�}�}�}�}$�}!�}(~%<~b~~�~�~�~�~
�~+=Oo'~��%���"�$2�2W���������Ԁ)��&�6�I�]�n�����"��"܁(��
(�
6�D�`�!|���#��)؂��4�E�b�g�j�}�����ƃ&ڃ��-�?� H�i�z���������ф�$�
1�?�^�n�{� ������҅����!�"A�d�"��(��͆ ن���(�<�0R���������‡ׇ�����'�	0�:�
O�]�
s���������Ј݈��&(�O�l�"����ω��/�L�c�o���
������	NJ&ъ)��$"�'G�&o�)��$��'�&
�)4�$^�'��&��)Ҍ$��'!�I�\�u�������ƍ֍�� �	4�>�Q�g�������ŽɎ	��������/�C�"Z�}�����
Əԏݏ���'�<�M�%c�&����ʐѐ��	���/�!E�g��������ő͑ґّ���(�E�W�s�������֒���7�K�i���������#��̓ԓ���(�5�I�"h�������ϔ�)��-)�W�g�����8��!ە��	��4-�b�w�D��
ϖږ�e��7b�������Ǘ
ۗ���(�.B�(q�������ɘ �� $�#E�!i�(�� ��+ՙ%�'�9�O�k�'|�����ɚٚ%��)�
H�V�m���
����	›
̛4ڛ&� 6�"W�%z�%��"Ɯ&��.�	E�O�)c���������ŝߝ����) �J�]�x����� ��ߞ� 	�*�&D�"k�)����"ҟ#���	 �*�	=�G�&S�z�*��#�����$�#>�b�n�z�������#��#֡=��M8�#��M��^��W�p�%����ƣ	ܣ���
�##�G�`�u���S���1
�<�A�I�
O�]�
f�t�!z�����åեۥ���"�(� 0�Q�o�v���,��4Ħ���+�;�Q�p���
������(֧,��,�!H�!j���$��*Ȩ$��,�F�`���������ԩ�	���f!�!��%��
Ъ۪���%�	1�;�fU���ū ث���%�8�W�s�
������
��¬Ԭ�"�!2�T�!h�"��#��ѭ�(�,� C�d�u�������!ٮ���+-�Y�
m�{�������̯�
����"�&?�f������� ǰ�0��*�$>�c�9{���űα���"�8�K�R�#b�����	��&²��
�� 7�$X�&}�,��ѳ����$�;�7X�����ƴܴ����9�H�*b�������ʵݵ���)�F�e����������׶"�"
�0�G�]�y�����	����˷ѷ��-�(?�h�"}�$��Ÿٸ߸�����&�:�B�,`�+��+������;%�da�ƺں�����+�=�T�t�������»߻.��*+�V�]�	x�������Ǽڼ�	�- �NN�������ӽ���
�+�+I�u���������
ɾ
׾�B��c?�(��	ֿ̿�����&�K2�e~�u�oZ�J�o�J������������������������������������� �#�&�)�0�4�7�:�Q�T�W�Z�]�`�c�f�i�l�o�r�x�|�������������������������������������������������������������������������������������������� �#�'�+�.�2�5�8�;�>�A�D�G�K�N�Q�T�W�Z�]�`�d�g�j�m�p�s�v�y�}��������������G�/�����9�W�m�����������3���,8�*e�����
��	����
��-��-!�&O�v���������X��2	�<�1T�*��������
��	�����
�
+�$9�^�d�{���E��������'�8�K�
]�k�x�����
������T��X5��������������*�
B�P�`�p�%w�	������������	����	�
&�	1�+;�	g�tq���
����(�5�S�o�!������
��������"�;�
M�[�w�������������(8�a�-��#��#����	�$�&?� f�!��������.��L�:k������������� �)�1�@�^�|��� ��"��
��T��RT�J����� �?�H]�?��Q��^8�Y��q��&c�������������
�*�H�Y�i�y�����������
���������-�H�b�{������������$�$D�i� ��5��,��
��-�9�?�(N�w�#�����������+�&>�e�{���*������ ��
�$�@�\�i�v����������������'�;�,D�'q���������$��C
�=N�0��*�������)(�R�o�������������8�J�\�r����(������&�-�%L�r��������6��C!�%e���*����'��!	�=+�i�y�	������=����(� >�_�	{�	��	��	��������������$��"�(2�&[�����������
��(�?�Y�p�*��
��+�����*)� T�u�~�,��:������1�!L�,n��������������'�!F�'h�)��������#��%�B�2a�4��������7�%<�b�z�������&��
�(�9�K�#W�{�������������&�(:�c�!s�������(������1�C�[�o�!��"��'��)��
%�$3�X�o�����6�����)�0�A�W�j���������	����
����
�� �")�L�f�u���!��&��	�")�L�l����������
6�A�U�	g�+q�1��(�.��+'�1S�(��.��+�1	�(;�.d�+��1��(�.�I�\�y����������� �	=�G�Z�$p��� �����	��	��8�@�R�f�"}���!����	���3�D�Z�p���+��,��
� �5�=�X�a�i�}�*�������
��$�,�1�#9�]�t���������2IZv�������)*
1<R%f��"���!2*R/}�#��#�N-`�
��F�6ZQ��#���Jy
���$,FUe(|"����� / O#p!�)� �++-Yk��'����	%*	)P	z	�	�	�	�	�		�	

M
-b
'�
)�
.�
+)=,g��	��)�8IOjo~��,��"�
/
L
 _
�
�
 �
�
&�
")/Y"s ������.�-4+b��&�$�#/;G`-i-�B�a!jI�[�2L-f��
����*
8Ri�m�3�@3ty�
����!����,@Gag p,����4�>']���!��!�
(=)Z-��"�(�*2,]$����!�9U[u��"���-Y,��#��.":�]��&)?R#c��
������!4Vu!��"��-I_~���� �(1*Z�
������ 
 % E 'K &s $� � � � � !2,!_!/s!�!;�!�!	""."7"W"&^"�"�"�"+�"�"#�"#"&#I#i#r#�#"�#(�#.�#0$K$`$x$�$�$�$@�$$%D%a%x%�%�%�%�%�%.&0&F&]&m&�&�&'�&'�&%'+'J'R'f'w'�'�'"�'#�'�'(&/(V(n(w(	�(�(�(�(�(�(.�(%.)T)#i)%�)�)�)�)�)�)
�)
*"*<*E*/a*.�*.�*�*++E/+uu+�+�+,%,,,3,
B,M,`, v,�,�,�,�,�,-4"-0W-�-�-�-�-�-�-�-. .8./T.\�.�.�.//,/=/S/?d/C�/�/0	00%0?0
P0[0Gu0t�0)21	\1f1x1~1�1�1(�1L�1a2ut2r�2O]3r�3N 4o4r4u4y4~4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4�4555
5
55555!5$5'5*5-505356595<5?5B5F5I5L5O5V5Y5\5_5b5e5h5k5n5r5u5x5{5~5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�5�56666666666!6$6�Xvm$�f}6���O�1�N��<\jo������d�J�[D��E�?��	?�+&2-
K�!��~�yF���+-@'�q��]c��ecmt;��R3&�o���ik����W���L���ud�M���[O����[�zT�z�
�k��(�,�k�Z�
������������:���!���G�2v>H�P��Z���)�{��s^"����$�1x�&���p/�)�L�����".����l'.�^�Q���'�78�jt����Y+�7?TW)#����*��	�C�w��S�5HF"a�=).��,BN���n]!M�z��@P�����
�_~�L> {�C�	�_S5���-���b��dc ��pKC��g4LPeY�3W�������(e��!��s`���-}b���?�^�!h��T�b��}���i�K�"�h��*GH����;7�i�����\�aw#���,�;���� �(,��B�f4����?�[2�RI��9��0	P����W��-wdD9�M�x�3:��JX���%u�S=�fA$@����
��R�����A�����$��GS'���<v�}�M�U�r�
������G*$��H��
B6 �Jfl�E����c���@�&�%IH�5VJ�*%������JOo8��Q�<��:�R��X.��Z+x���N�\�����]�*ks��h�5��%�����y�9</
�g0Oj��V�|I��2n=i6�E�t7�89����1�a5��b��p��64P��uyY���/46����U�<����8G{7�Vg;�3#v�(��=I��Yo0�p|;��Z�Z����U�q"��s�_���~F2���B~�(:D��\�]g�Edr��CK��e�����0����Y�A[�Vy1���Mr���K����D�t��0�B�>L3���RV'�c_�1>���z�q�
FQ#��`�+n���\I��Umf��m��D�/|���r���b����ET4U�@��u,�)S	^��X�j��Q�hxw`n��9Q�al�O�>N�C���:�NT���]� _.�%�`e&F�q8X�a^|
����=�i`Al��/g��{�W���#Ah�����&lt;Less/Greater&gt;&lt;Less/Greater&gt; chooses 5th level; acts as onetime lock when pressed together with another 5th level chooser&lt;Less/Greater&gt;; acts as onetime lock when pressed together with another 3rd level chooser3rd level of &lt;Less/Greater&gt;3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL Keyboard Symbols: APLX Unified APL LayoutAPL Keyboard Symbols: IBM APL2APL Keyboard Symbols: Manugistics APL*PLUS IIAPL Keyboard Symbols: Unified LayoutAPL Keyboard Symbols: saxATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulate PC keys (PrtSc, Scroll Lock, Pause, Num Lock)Apple laptopArabicArabic (AZERTY)Arabic (AZERTY/digits)Arabic (Algeria)Arabic (Buckwalter)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (digits)Arabic (qwerty/digits)Arabic (with extensions for Arabic-written other languages and Arabic digits preferred)Arabic (with extensions for Arabic-written other languages and European digits preferred)ArmenianArmenian (OLPC phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus laptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Probhat)Bangla (India, Uni Gitanjali)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt. ISO)Belgian (alt.)Belgian (alt., Latin-9 only)Belgian (alt., with Sun dead keys)Belgian (no dead keys)Belgian (with Sun dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt. phonetic)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US, with Bosnian digraphs)Bosnian (US, with Bosnian letters)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed)Braille (right-handed)Brother InternetBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon Multilingual (AZERTY)Cameroon Multilingual (Dvorak)Cameroon Multilingual (QWERTY)Canadian MultilingualCanadian Multilingual (1st part)Canadian Multilingual (2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock behaviorCaps Lock is also a CtrlCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US, with Croatian digraphs)Croatian (US, with Croatian letters)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt; Alt is mapped to WinCtrl is mapped to Win and the usual Ctrl keysCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCzechCzech (QWERTY)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (with &lt;\|&gt; key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Win keys)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (standard)Dutch (with Sun dead keys)Dyalog APL completeDzongkhaElfdalian (Swedish, with combining ogonek)Enable extra typographic charactersEnglish (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended, with Win keys)English (UK, intl., Macintosh)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, alt. intl.)English (US, euro on 5)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US, with Estonian letters)Estonian (no dead keys)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Winkeys)Finnish (classic)Finnish (classic, no dead keys)Finnish DvorakFour-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Switzerland, with Sun dead keys)French (Togo)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (alt., with Sun dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (legacy, alt., with Sun dead keys)French (no dead keys)French (with Sun dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PC (intl.)Generic 104-key PCGeneric 105-key PC (intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Austria, with Sun dead keys)German (Bone)German (Bone, eszett home row)German (Dvorak)German (KOY)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo qwerty)German (Neo qwertz)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (Switzerland, with Sun dead keys)German (T3)German (US, with German letters)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters and no dead keys)German (with Sun dead keys)German LadinGreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHtc Dream phoneHungarianHungarian (101/QWERTY/comma/dead keys)Hungarian (101/QWERTY/comma/no dead keys)Hungarian (101/QWERTY/dot/dead keys)Hungarian (101/QWERTY/dot/no dead keys)Hungarian (101/QWERTZ/comma/dead keys)Hungarian (101/QWERTZ/comma/no dead keys)Hungarian (101/QWERTZ/dot/dead keys)Hungarian (101/QWERTZ/dot/no dead keys)Hungarian (102/QWERTY/comma/dead keys)Hungarian (102/QWERTY/comma/no dead keys)Hungarian (102/QWERTY/dot/dead keys)Hungarian (102/QWERTY/dot/no dead keys)Hungarian (102/QWERTZ/comma/dead keys)Hungarian (102/QWERTZ/comma/no dead keys)Hungarian (102/QWERTZ/dot/dead keys)Hungarian (102/QWERTZ/dot/no dead keys)Hungarian (QWERTY)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (no dead keys)Icelandic (with Sun dead keys)IgboIndianInternational Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US, with Italian letters)Italian (Winkeys)Italian (intl., with dead keys)Italian (no dead keys)Italian LadinJapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)LatvianLatvian (F)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US, with Lithuanian letters)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional EscMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (with US layout)Manipuri (Eeyek)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia 1.0AMiscellaneous compatibility optionsMmuockMoldavianMoldavian (Gagauz)MongolianMontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Latin with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Multilingual (Canada, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Northern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Win keys)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrow keys. Num Lock off: arrow keys (as in Windows)Numeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Win keys)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)PolishPolish (Colemak)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Macintosh, with Sun dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Portuguese (with Sun dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Win keys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, with Win keys)Russian (typewriter)Russian (typewriter, legacy)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, ZE and ZHE swapped)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US, with Sinhala letters)Sinhala (phonetic)SlovakSlovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US, with Slovenian letters)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Latin American, with Sun dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Win keys)Spanish (dead tilde)Spanish (no dead keys)Spanish (with Sun dead keys)Special keys (Ctrl+Alt+&lt;key&gt;) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Key compatibilitySun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US, with Swedish letters)Swedish (based on US Intl. Dvorak)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a QWERTY layoutToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)Turkish (with Sun dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Win keys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Win keys)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to show alternative layoutUsing space key to input non-breaking spaceUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseViewSonic KU-306 InternetWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Win is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config-2.23.99
Report-Msgid-Bugs-To: svu@users.sourceforge.net
POT-Creation-Date: 2019-10-19 21:52+0100
PO-Revision-Date: 2018-06-14 09:13+0200
Last-Translator: Fabio Tomat <f.t.public@gmail.com>
Language-Team: Friulian <f.t.public@gmail.com>
Language: fur
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
X-Generator: Poedit 2.0.7
Plural-Forms: nplurals=2; plural=(n != 1);
&lt;Mancul di/Plui grant di&gt;&lt;Mancul di/Plui grant di&gt; al sielç il cuint nivel; al agjìs come un bloc par une volte sole cuant che si frache adun cuntun altri seletôr di cuint nivel&lt;Mancul di/Plui grant di&gt;; al agjìs come bloc par une volte sole cuant che si frache adun cuntun altri seletôr di tierç nivelTierç nivel di &lt;Mancul di/Plui grant di&gt;Tierç nivel dal BlocMaiuscTierç nivel dal Ctrl a çampeTierç nivel dal Win a çampeTierç nivel di MenùTierç nivel dal Ctrl diestriTierç nivel dal Win diestriA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSimbui tastiere APL: disposizion APL unificade APLXSimbui tastiere APL: IBM APL2Simbui tastiere APL: Manugistics APL*PLUS IISimbui tastiere APL: disposizion unificadeSimbui tastiere APL: saxATM/stîl-telefonAcer AirKey VAcer C300Acer Ferrari 4000Portatil AcerZonte il compuartament standard al tast MenùZonte des letaris supersegnadis dal EsperantoZontâ simbui di valude a cualchi tastAdvance Scorpius KIAfganeAkanAlbaneseAlbanese (Plisi)Permet di interompi la cature cun lis azions di tastiere (atenzion: pericul di sigurece)Permet di caturâ e regjistrâ l'arbul dai barconsAlt e Meta a son su AltAlt al è aplicât al Win diestri, Super al MenùAlt al è aplicât a Win e ai Alt abituâiAlt al è scambiât cun WinAlt+BlocMaiuscAlt+CtrlAlt+MaiuscAlt+SpaziCompuartament tast Alt/WinAmharicCualsisei AltCualsisei WinCualsisei Win (intant che si frache)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulazion tascj PC (Stamp, BlocScor, Pause, BlocNum)Portatil AppleArabeArabe (AZERTY)Arabe (AZERTY/cifris)Arabe (Algjerie)Arabe (Buckwalter)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (QWERTY)Arabe (Sun Type 6/7)Arabe (Sirie)Arabe (cifris)Arabe (qwerty/cifris)Arabe (cun estensions par altris lenghis e cifris arabis preferidis scritis in arap)Arabe (cun estensions par altris lenghis e cifris europeanis preferidis scritis in arap)ArmeneArmene (OLPC fonetiche)Armene (alt. orientâl)Armene (alt. fonetiche)Armene (orientâl)Armene (fonetiche)Armene (ocidentâl)Asturiane (Spagne, cun H e L cun pont bas)Portatil AsusIn bas a çampeA çampe di 'A'AtsinaFrancese (vecje maniere, alternative)AvesticheAzereAzere (ciriliche)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashSbare invierse; cuant che e ven fracade adun cuntun altri seletôr di tierç nivel, e agjìs come bloc par une volteBambaraBangladeshBangladesh (Indie)Bangladesh (Indie, inscrizion Baishakhi)Bangladesh (Indie, Baishakhi)Bangladesh (Indie, Bornona)Bangladesh (Indie, Probhat)Bangladesh (Indie, Uni Gitanjali)Bangladesh (Probhat)BaschireBielorusseBielorusse (latine)Bielorusse (vecje maniere)BelgheBelghe (Sun Type 6/7)Belghe (Wang 724 AZERTY)Belghe (alt. ISO)Belghe (alt.)Belghe (alt., dome latin-9)Belghe (alt., tascj muarts Sun)Belghe (cence tascj muarts)Belghe (cun tascj muarts Sun)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbare (Algjerie, latine)Berbare (Algjerie, Tifinagh)Berbare (Maroc, alt. fonetiche Tifinagh)Berbare (Maroc, alt. Tifinagh)Berbare (Maroc, Tifinagh fonetiche slargjade)Berbare (Maroc, Tifinagh slargjade)Berbare (Maroc, fonetiche Tifinagh)Berbare (Maroc, Tifinagh)BosgnacheBosgnache (US, cun digrafs bosgnacs)Bosgnache (US, cun letaris bosgnachis)Bosgnache (cun digrafs bosgnacs)Bosgnache (cun virgulutis bassis)Ducj i doi i Alt adunDucj i doi i Ctrl adunDucj i doi i Maiusc adunDucj i doi i Maiusc adun a abilitin BlocMaiuscDucj i doi i Maiusc adun a abilitin BlocMaiusc; un tast Maiusc lu disabiliteDucj i doi i Maiusc adun a abilitin il stât di BlocMaiuscBrailleBraille (çampine)Braille (man drete)Brother InternetBulgareBulgare (fonetiche gnove)Bulgare (fonetiche tradizionâl)BirmaneBirmane ZawgyiCamerun plurilengâl (AZERTY)Camerun plurilengâl (Dvorak)Camerun plurilengâl (QWERTY)Canadese plurilengâlCanadese plurilengâl (prin toc)Canadese plurilengâl (secont toc)BlocMaiuscBlocMaiusc (intant che si frache), Alt+BlocMaiusc pe azion origjinarie di BlocMaiuscBlocMaiusc al agjìs come Maiusc cul bloc; Maiusc al met in “pause” BlocMaiuscBlocMaiusc al agjìs come Maiusc cul bloc; Maiusc nol influence BlocMaiuscBlocMaiusc come CtrlCompuartament BlocMaiuscBlocMaiusc al è ancje un CtrlBlocMaiusc al è disabilitâtBlocMaiusc ae prime disposizion; Maiusc+BlocMaiusc ae ultime disposizionBlocMaiusc al comute Maiusc cussì di vê efiet su ducj i tascjBlocMaiusc al comute l'ûs normâl des letaris maiusculis dai caratars alfabeticsBlocMaiusc al fâs ûs interni des letaris maiusculis. Maiusc al met in “pause” BlocMaiuscBlocMaiusc al fâs ûs des letaris maiusculis internis; Maiusc nol à efiet su BlocMaiuscBlocMaiusc; al agjìs come bloc par une volte sole cuant che si frache adun cuntun altri seletôr di tierç nivelCatalane (Spagne, cun L cun pont medi)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420CineseSlâf eclesiasticChuvashChuvash (latine)Classmate PCCloGaelachCoeur d'Alene SalishPortatil Compaq ArmadaCompaq Easy AccessCompaq Internet (13 tascj)Compaq Internet (18 tascj)Compaq Internet (7 tascj)Portatil Compaq PresarioCompaq iPaqCreative Desktop Wireless 7000Tatare de Crimee (Dobruze Q)Tatare de Crimee (Alt-Q Turche)Tatare de Crimee (F Turche)Tatare de Crimee (Q Turche)CravuateCravuate (cun digrafs cravuats)Cravuate (US, cun letaris cravuatis)Cravuate (cun digafs cravuats)Cravuate (cun virgulutis bassis)Ctrl al è aplicât ai Alt; Alt al è aplicât ai WinCtrl al è aplicât ai Win e i Ctrl abituâiPosizion CtrlCtrl+Alt+BackspaceCtrl+MaiuscCecheCeche (QWERTY)Ceche (QWERTY, sbare invierse estindude)Ceche (Sun Type 6/7)Ceche (UCW, nome letaris acentadis)Ceche (US, Dvorak, supuart UCW)Ceche (cun tascj &lt;\|&gt;)Ceche Slovache e Todescje (US)DTK2000DaneseDanese (Dvorak)Danese (Macintosh)Danese (Macintosh, cence tascj muarts)Danese (Sun Type 6/7)Danese (tascj Win)Danese (cence tascj muarts)Tascj predefinîts de tastierute numericheDellDell 101-tascj PCPortatil Dell Inspiron 6000/8000Portatil Dell LatitudePortatil Dell Precision M65Portatil Dell Precision M65Dell SK-8125Dell SK-8135Dell USB multimediâlDexxa Wireless DesktopDhivehiDiamond 9801/9802OlandeseOlandese (Macintosh)Olandese (Sun Type 6/7)Olandese (standard)Olandese (cun tascj muarts Sun)Dyalog APL completeDzongkhaElfdaliane (Svedese, cun combinazion ogonek)Abilite caratars tipografics adizionâiInglese (Australiane)Inglese (Camerun)Inglese (Canadà)Inglese (Carpalx)Inglese (Carpalx, otimizazion plene)Inglese (Carpalx, otimizazion plene, intl., cun tascj muarts AltGr)Inglese (Carpalx, otimizazion plene, intl., cun tascj muarts)Inglese (Carpalx, intl., cun tascj muarts AltGr)Inglese (Carpalx, intl., cun tascj muarts)Inglese (Colemak)Inglese (Dvorak)Inglese (Dvorak, alt. intl.)Inglese (Dvorak, intl. ,cun tascj muarts)Inglese (Dvorak, man çampe)Inglese (Dvorak, man drete)Inglese (Ghana)Inglese (Ghana, GILLBT)Inglese (Ghana, plurilengâl)Inglese (Indie, cun rupie)Inglese (Macintosh)Inglese (Mali, US, Macintosh)Inglese (Mali, US, intl.)Inglese (Nigerie)Inglese (Normane)Inglese (Sud Afriche)Inglese (UK)Inglese (UK, Colemak)Inglese (UK, Dvorak)Inglese (UK, Dvorak, cun puntuazions UK)Inglese (UK, Macintosh)Inglese (UK, Sun Type 6/7)Inglese (UK, estindude, cun tascj Win)Inglese (UK, intl., Macintosh)Inglese (UK, intl., cun tascj muarts)Inglês (US)Inglese (US, IBM Arabe 238_L)Inglese (US, Sun Type 6/7)Inglese (UK, alt. intl.)Inglese (US, euro sul 5)Inglese (US, internazionâl cumbinazion AltGr Unicode)Inglese (US, internazionâl cumbinazion AltGr Unicode, alternative)Inglese (US, intl., cun tascj muarts)Inglese (operari)Inglese (operari, intl., cun tascj muarts)Inglese (Dvorak classic)Inglese (intl., cun tascj muarts AltGr)Inglese (Dvorak par programadôr)Inglese (i tascj divît/moltipliche a cambiin la disposizion)Ennyah DKB-1008Invie su la tastieruteEsperantoEsperanto (Brasîl, natîf)Esperanto (Portugal, natîf)Esperanto (pont e virgule e virgulutis spostadis, sorpassade)EstoneEstone (Dvorak)Estone (Sun Type 6/7)Estone (US, cun letaris estonis)Estone (cence tascj muarts)Euro su 2Euro su 4Euro su 5Euro su EEverex STEPnoteEweFL90FaroeseFaroese (cence tascj muarts)FilipineFilipine (Capewell-Dvorak, Baybayin)Filipine (Capewell-Dvorak, Latine)Filipine (Capewell-QWERF 2006, Baybayin)Filipine (Capewell-QWERF 2006, Latine)Filipine (Colemak, Baybayin)Filipine (Colemak, Latine)Filipine (Dvorak, Baybayin)Filipine (Dvorak, Latine)Filipine (QWERTY, Baybayin)FinlandeseFinlandese (DAS)Finlandese (Macintosh)Finlandese (Sun Type 6/7)Finlandese (tascj Win)Finlandese (classiche)Finlandese (classiche, cence tascj muarts)Danese DvorakTast di cuart nivel cun separadôrs astratsTast di cuart nivel cun virguleTast di cuart nivel cun pontTast di cuart nivel cun pont, dome Latin-9Tast di cuart nivel cun momayyezFranceseFrancese (AZERTY)Francese (Bepo, ergonomiche, maniere Dvorak)Francese (Bepo, ergonomiche, maniere Dvorak, dome latin-9)Francese (Bretone)Francese (Camerun)Francese (Canadà)Francese (Canadà, Dvorak)Francese (Canadà, vecje maniere)Francese (Republiche democratiche dal Congo)Francese (Dvorak)Francese (Guinee)Francese (Macintosh)Francese (Mali, alt.)Francese (Maroc)Francese (Sun Type 6/7)Francese (Svuizare)Francese (Svuizare, Macintosh)Francese (Svuizare, Sun Type 6/7)Francese (Svuizare, cence tascj muarts)Francese (Svuizare, cun tascj muarts Sun)Francese (Togo)Francese (alt.)Francese (alt., dome latin-9)Francese (alt., cence tascj muarts)Francese (alt., cun tascj muarts Sun)Francese (vecje maniere, alt.)Francese (vecje maniere, alt., cence tascj muarts)Francese (vecje maniere, alt., cun tascj muarts Sun)Francese (cence tascj muarts)Francese (cun tascj muarts Sun)Furlane (Italie)Portatil Amilo Fujitsu-SiemensFulaFrancese (vecje maniere, alternative)Gjeneriche 101-tascj PCGjeneriche 102-tascj PC (intl.)Gjeneriche 104-tascj PCGjeneriche 105-tascj PC (Intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGjeorgjianeGjeorgjiane (France, AZERTY Tskapo)Gjeorgjiane (Italie)Gjeorgjiane (MESS)Gjeorgjiane (ergonomiche)TodescjeTodescje (Aus der Neo-Welt)Todescje (Austrie)Todescje (Austrie, Macintosh)Todescje (Austrie, cence tascj muarts)Todescje (Austrie, cun tascj muarts Sun)Todescje (Bone)Todescje (Bone, rie inizi eszett)Todescje (Dvorak)Todescje (KOY)Todescje (Macintosh)Todescje (Macintosh, cence tascj muarts)Todescje (Neo 2)Todescje (Neo qwerty)Todescje (Neo qwertz)Todescje (QWERTY)Todescje (Sun Type 6/7)Todescje (Svuizare)Todescje (Svuizare, Macintosh)Todescje (Svuizare, Sun Type 6/7)Todescje (Svuizare, vecje maniere)Todescje (Svuizare, cence tascj muarts)Todescje (Svuizare, cun tascj muarts Sun)Todescje (T3)Todescje (US, cun letaris todescjis)Todescje (acût muart)Todescje (acût grâf muart)Todescje (tilde muarte)Todescje (cence tascj muarts)Todescje (cun letaris Ongjaresis e cence tascj muarts)Todescje (cun tascj muarts Sun)Todescje ladineGrecheGreche (Colemak)Greche (Sun Type 6/7)Greche (slargjade)Greche (cence tascj muarts)Greche (politoniche)Greche (semplice)GujaratiGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigerie)EbraicheEbraiche (Bibliche, SIL fonetiche)Ebraiche (bibliche, Tiro)Ebraiche (lyx)Ebraiche (fonetiche)Hewlett-Packard InternetPortatil Hewlett-Packard Mini 110Hewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020EsadecimâlHindi (Bolnagri)Hindi (KaGaPa fonetiche)Hindi (Wx)Honeywell EuroboardTelefon Htc DreamOngjareseOngjarese (101/QWERTY/virgule/tascj muarts)Ongjarese (101/QWERTY/virgule/cence tascj muarts)Ongjarese (101/QWERTY/pont/tascj muarts)Ongjarese (101/QWERTY/pont/cence tascj muarts)Ongjarese (101/QWERTZ/virgule/tascj muarts)Ongjarese (101/QWERTZ/virgule/cence tascj muarts)Ongjarese (101/QWERTZ/pont/tascj muarts)Ongjarese (101/QWERTZ/pont/cence tascj muarts)Ongjarese (102/QWERTY/virgule/tascj muarts)Ongjarese (102/QWERTY/virgule/cence tascj muarts)Ongjarese (102/QWERTY/pont/tascj muarts)Ongjarese (102/QWERTY/pont/cence tascj muarts)Ongjarese (102/QWERTZ/virgule/tascj muarts)Ongjarese (102/QWERTZ/virgule/cence tascj muarts)Ongjarese (102/QWERTZ/pont/tascj muarts)Ongjarese (102/QWERTZ/pont/cence tascj muarts)Ongjarese (QWERTY)Ongjarese (cun tascj muarts)Ongjarese (standard)Hyper al è aplicât ai WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandeseIslandese (Dvorak)Islandese (Macintosh)Islandese (Macintosh, vecje maniere)Islandese (cence tascj muarts)Islandese (cun tascj muarts Sun)IgboIndianeAlfabet fonetic internazionâlInuktitutIrakianeIrlandeseIrlandese (UnicodeEspert)TalianeTaliane (IBM 142)Taliane (Macintosh)Taliane (Sun Type 6/7)Taliane (US, cun letaris talianis)Taliane (tascj Win)Taliane (intl., cun tascj muarts)Taliane (cence tascj muarts)Taliane LadineGjaponeseGjaponese (Dvorak)Gjaponese (Kana 86)Gjaponese (Kana)Gjaponese (Macintosh)Gjaponese (OADG 109A)Gjaponese (PC-98)Gjaponese (Sun Type 6)Gjaponese (Sun Type 7 - compatibile cun pc)Gjaponese (Sun Type 7 - compatibile cun sun)Opzions tastiere gjaponeseKalmykIl tast Kana Lock al sta blocantKannadaKannada (KaGaPa fonetiche)CassubieKazakheKazakhe (slargjade)Kazakhe (cun russe)Secuence di tascj par copâ il servidôr XTast par sielzi il cuint nivelTast par sielzi il tierç nivelKeytronic FlexProKhmer (Camboze)KikuyuKinesisKomiCoreaneCoreane (compatibile 101/104 tascj)Coreane (Sun Type 6/7)Tascj Hangul/Hanja coreansCurde (Iran, arabe-latine)Curde (Iran, F)Curde (Iran, latine Alt-Q)Curde (Iran, latine Q)Curde (Irak, arabe-latine)Curde (Irak, F)Curde (Irak, latine Alt-Q)Curde (Irak, latine Q)Curde (Sirie, F)Curde (Sirie, latine Alt-Q)Curde (Sirie, latine Q)Curde (Iran, F)Curde (Turchie, latine Alt-Q)Curde (Turchie, latine Q)KutenaiKirghizeKirghize (fonetiche)LaoLao (disposizion standard proponude STEA)LetoneLetone (F)Letone (Sun Type 6/7)Letone (US Colemak)Letone (US Colemak, variant apostrof)Letone (US Dvorak)Letone (US Dvorak, variant Y)Letone (US Dvorak, variant mancul)Letone (adatade)Letone (apostrof)Letone (ergonomiche, ŪGJRMV)Letone (moderne)Letone (programadôr US Dvorak)Letone (programadôr US Dvorak, variant Y)Letone (programadôr US Dvorak, variant mancul)Letone (tilde)Disposizion de tastierute numericheAlt a çampeAlt a çampe (intant che si frache)Alt a çampe come Ctrl, Ctrl a çampe come Win, Win a çampe come Alt a çampeAlt a çampe al è scambiât cun Win a çampeAlt a çampe+Maiusc a çampeCtrl a çampeMeta come Ctrl a çampeCtrl a çampe ae prime disposizion, Ctrl diestri ae ultime disposizionCtrl a çampe+Maiusc a çampeCtrl a çampe+Win a çampeCtrl a çampe+Win a çampe ae prime disposizion; Ctrl diestri+Menù ae seconde disposizionMaiusc a çampeWin a çampeWin a çampe (intant che si frache)Win a çampe al sielç il cuint nivel; al agjìs come bloc par une volte cuant che al ven fracât adun cuntun altri seletôr di cuint nivelWin a çampe ae prime disposizion; Win diestri/Menù ae ultime disposizionVecje maniereWang 724 vecje maniereTast vecje maniere cun virguleTast vecje maniere cun pontLituaneLituane (IBM LST 1205-92)Lituane (LEKP)Lituane (LEKPa)Lituane (Sun Type 6/7)Lituane (Dvorak US cun letaris lituanis)Lituane (US, cun letaris lituanis)Lituane (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2ᵉ alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTascj adizionâi Logitech G15 vie G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBSorabe inferiôrSorabe inferiôr (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedoneMacedone (cence tascj muarts)MacintoshMacintosh OldManten la compatibilitât dai tascj cun i vecjos codiçs dai tascj di SolarisFâs deventâ BlocMaiusc un Backspace in pluiFâs deventâ BlocMaiusc un Esc in pluiFâs deventâ BlocMaiusc un Hyper in pluiFâs deventâ BlocMaiusc un tast Menù in pluiFâs deventâ BlocMaiusc un BlocNum in pluiFâs deventâ BlocMaiusc un Super in pluiFâs deventâ Zenkaku Hankaku un Esc in pluiMalese (Jawi, tastiere arabe)Malese (Jawi, fonetiche)MalayalamMalayalam (Lalitha)Malayalam (Inscrizion miorade, cun rupie)MalteseMaltese (cun disposizion US)Manipuri (Eeyek)MaoriMarathi (KaGaPa fonetiche)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenùTast Menù (fracât), Maiusc+Menù par MenùMenù come Ctrl diestriMeta al è aplicât a Win a çampeMeta al è aplicât ai WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Svedese)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia 1.0AOpzions varis di compatibilitâtMmuockMoldaveMoldave (Gagauz)MonguleMontenegrineMontenegrine (Ciriliche cun virgulutis bassis)Montenegrine (Ciriliche)Montenegrine (Ciriliche, ZE e ZHE scambiadis)Montenegrine (Latine cun virgulutis bassis)Montenegrine (Latine, QWERTY)Montenegrine (Latine, Unicode)Montenegrine (Latine, Unicode, QWERTY)Plurilengâl (Canadà, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Backspace stîl NICOLA-FNepaleseCaratar di spazi no separabil al secont nivelCaratar di spazi no separabil al tierç nivelCaratar di spazi no separabil al tierç nivel, nuie al cuart nivelCaratar di spazi no separabil al tierç nivel, caratar di spazi stret no separabil al cuart nivelSpazi no separabil al cuart nivelSpazi no separabil al cuart nivel, spazi stret no separabil al sest nivelSpazi no separabil al cuart nivel, spazi stret no separabil al sest nivel (vie Ctrl+Maiusc)Saami dal nord (Finlande)Saami dal nord (Norvegje)Saami dal nord (Norvegje, cence tascj muarts)Saami dal nord (Svezie)Northgate OmniKey 101NorvegjeseNorvegjese (Colemak)Norvegjese (Dvorak)Norvegjese (Macintosh)Norvegjese (Macintosh, cence tascj muarts)Norvegjese (Sun Type 6/7)Norvegjese (tascj Win)Norvegjese (cence tascj muarts)BlocNumBlocNum impiât: cifris; Maiusc pai tascj di direzion. BlocNum distudât: tascj di direzion (come in Windows)Compuartament dal tast canc de tastierute numericheLa tastierute numeriche e inserìs simpri cifris (come in macOS)OLPCOcitaneOghamOgham (IS434)Ol ChikiOngjarese vecjeOriyaOrtek Multimedia/Internet MCK-800Ossete (Gjeorgjie)Ossete (tascj Win)Ossete (vecje maniere)PC-98Rutenie pannonichePosizion parentesisPashtoPashto (Afganistan, OLPC)PausePersianePersiane (Afganistan, Dari OLPC)Persiane (cun tastierute numeriche persiane)PolachePolache (Colemak)Polache (Dvorak)Polache (Dvorak, cun virgulutis polachis sul tast 1)Polache (Dvorak, cun virgulutis polachis sul tast di citazion)Polache (Gjermanie, cence tascj muarts)Polache (Glagolica)Polache (QWERTZ)Polache (Sun Type 6/7)Polache (intl., cun tascj muarts)Polache (vecje maniere)Polache (Dvorak par programadôr)PortughesePortughese (Brasîl)Portughese (Brasîl, Dvorak)Portughese (Brasîl, IBM/Lenovo ThinkPad)Portughese (Brasîl, natîf par tastieris US)Portughese (Brasîl, natîf)Portughese (Brasîl, Sun Type 6/7)Portughese (Brasîl, cence tascj muarts)Portughese (Macintosh)Portughese (Macintosh, cence tascj muarts)Portughese (Macintosh, cun tascj muarts Sun)Portughese (natîf par tastieris US)Portughese (natîf)Portughese (Sun Type 6/7)Portughese (cence tascj muarts)Portughese (cun tascj muarts Sun)Posizion dal tast ComponiPropeller Voyager KTEZ-1000StampPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Alt diestriAlt diestri (intant che si frache)Alt diestri al sielç il cuint nivel; cuant che al ven fracât adun cuntun altri seletôr di cuint nivel, al agjìs come bloc par une volteIl Alt diestri nol sielç mai il tierç nivelAlt diestri, Maiusc+Alt diestri come ComponiCtrl diestriCtrl diestri (intant che si frache)Ctrl diestri come Alt diestriCtrl diestri+Maiusc diestriMaiusc diestriWin diestriWin diestri (intant che si frache)Win diestri al sielç il cuint nivel; al agjìs come bloc par une volte cuant che al ven fracât adun cuntun altri seletôr di cuint nivelRumeneRumene (Gjermanie)Rumene (Gjermanie, cence tascj muarts)Rumene (Sun Type 6/7)Rumene (tascj Win)Rumene (cedilie)Rumene (gjenar di contat ergonomic)Rumene (standard cedilie)Rumene (standard)Rupie su 4RusseRusse (Ceche, fonetiche)Russe (DOS)Russe (Gjeorgjie)Russe (Gjermanie, fonetiche)Russe (Gjermanie, conseade)Russe (Gjermanie, trasliterazion)Russe (Kazakhstan, cun Kazakh)Russe (Macintosh)Russe (Polonie, fonetiche Dvorak)Russe (Poliglote e reazionarie)Russe (Rulemak, fonetiche Colemak)Russe (Sun Type 6/7)Russe (Svezie, fonetiche)Russe (Svezie, fonetiche, cence tascj muarts)Russe (US, fonetiche)Russe (Ucraine, standard RSTU)Russe (vecje maniere)Russe (fonetiche)Russe (fonetiche, AZERTY)Russe (fonetiche, Dvorak)Russe (fonetiche, francese)Russe (fonetiche, cun tascj Win)Russe (machine di scrivi)Russe (machine di scrivi, vecje maniere)Russe (cun disposizion Ucraine-Bielorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanscrit (KaGaPa fonetiche)Sanwa Supply SKB-KG3BlocScorSecwepemctsinPont e virgule sul tierç nivelSerbeSerbe (Ciriliche cun virgulutis bassis)Serbe (Ciriliche, ZE e ZHE scambiadis)Serbe (Latine cun virgulutis bassis)Serbe (latine)Serbe (latine, QWERTY)Serbe (latine, Unicode)Serbe (latine, Unicode, QWERTY)Serbe (Russie)Serbe (cumbinazion acents invezit di tascj muarts)Serbe-Cravuate (US)Maiusc + BlocNum al abilite i tascj di direzionMaiusc al anule BlocMaiuscMaiusc nol anule BlocNum, invezit al sielç il tierç nivelMaiusc+BlocMaiuscSicilianeSiciliane (tastiere US)SlesianeSilvercrest Multimedia WirelessSindhiCingalese (US, cun letaris cingalesis)Cingalese (fonetiche)SlovacheSlovache (QWERTY)Slovache (QWERTY, sbare invierse estindude)Slovache (Sun Type 6/7)Slovache (sbare invierse estindude)SloveneSlovene (US, cun letaris slovenis)Slovene (cun virgulutis bassis)SpagnoleSpagnole (Dvorak)Spagnole (Americhe latine)Spagnole (Americhe latine, Dvorak)Spagnole (Americhe latine, tilde muarte)Spagnole (Americhe latine, cence tascj muarts)Spagnole (Americhe latine, cun tascj muarts Sun)Spagnole (Macintosh)Spagnole (Sun Type 6/7)Spagnole (tascj Win)Spagnole (tilde muarte)Spagnole (cence tascj muarts)Spagnole (cun tascj muarts Sun)Tascj speciâi (Ctrl+Alt+&lt;tast&gt;) gjestîts intun servidôrSteelSeries Apex 300 (Apex RAW)Compatibilitât cun tast SunSun Type 6 (gjaponese)Sun Type 6 USB (gjaponese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (europeane)Sun Type 7 USBSun Type 7 USB (europeane)Sun Type 7 USB (gjaponese)/Gjaponese 106-tascjSun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Scambiâ Ctrl e BlocMaiuscScambiâ ESC e BlocMaiuscScambiâ Alt a çampe cun Ctrl a çampeScambiâ Win a çampe cun Ctrl a çampeScambiâ Win diestri cun Ctrl diestriScambie cun parentesis cuadrisSvedeseSvedese (Dvorak A5)Svedese (Dvorak)Svedese (Macintosh)Svedese (Sun Type 6/7)Svedese (Svdvorak)Svedese (US, cun letaris svedesis)Svedese (basade su US Dvorak Intl.)Svedese (cence tascj muarts)Lengaç segns svedêsDaûr a passâ a une altre disposizionSymplon PaceBook tabletSiriacheSiriache (fonetiche)TaiwaneseTaiwanese (indigjene)TazicheTaziche (vecje maniere)Tamil (Inscrizion)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, codifiche TAB)Tamil (TamilNet '99 cun numars Tamil)Tamil (TamilNet '99)Tamil (TamilNet '99, codifiche TAB)Tamil (TamilNet '99, codifiche TSCII)Targa Visionary 811TatareTeluguTelugu (KaGaPa fonetiche)Telugu (Sarala)TailandeseTailandese (Pattachote)Tailandese (TIS-820.2538)TibetaneTibetane (cun numars ASCII)Al tast corispondent intune disposizion ColemakAl tast corispondent intune disposizion DvorakAl tast corispondent intune disposizion QWERTYToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Tastiere di computer pardabon ergonomiche Model 227 (tascj Alt larcs)Tastiere di computer pardabon ergonomiche Model 229 (tascj Alt di dimension standard, tascj Super e Menù adizionâi)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcheTurche (Alt-Q)Turche (F)Turche (Gjermanie)Turche (Sun Type 6/7)Turche (intl., cun tascj muarts)Turche (cun tascj muarts Sun)TurkmeneTurkmene (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (modalitât 102/105:EU)TypeMatrix EZ-Reach 2030 USB (modalitât 106:JP)UdmurtUgaritiche al puest de arabeUcraineUcraine (Sun Type 6/7)Ucraine (tascj Win)Ucraine (omofoniche)Ucraine (vecje maniere)Ucraine (fonetiche)Ucraine (standard RSTU)Ucraine (machine di scrivi)Zontis Unicode (frecis e operadôrs matematics)Zontis Unicode (frecis e operadôrs matematics; operadôrs matematics sul nivel predefinît)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (tascj Win)Urdu (alt. fonetiche)Urdu (fonetiche)Doprâ i LED de tastiere par mostrâ la disposizion alternativeSi dopre il tast spazi par inserî il caratar di spazi no separabilSolit spazi a ogni nivelUyghureUzbecheUzbeke (Afganistan)Uzbeke (Afganistan, OLPC)Uzbeche (Latine)VietnamiteViewSonic KU-306 InternetTastierute Wang 724 cun zontis Unicode (frecis e operadôrs matematics)Tastierute Wang 724 cun zontis Unicode (frecis e operadôrs matematics; operadôrs matematics sul nivel predefinît)Win al è aplicât a Stamp i Win abituâiWin+SpaziWinbook Model XP5WolofYahoo! InternetJakuteYorubaNo-union a largjece nule al secont nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivel, nuie al cuart nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivel, spazi stret no separabil al cuart nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivel, union a largjece nule al cuart nivelNo-union a largjece nule al secont nivel, union a largjece nule al tierç nivelNo-union a largjece nule al secont nivel, union a largjece nule al tierç nivel, spazi no separabil al cuart nivelNo-union a largjece nule al tierç nivel, union a largjece nule al cuart nivelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzPortatil eMachines m6800eeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh